This work is licensed under a Creative Commons Attribution 4.0 International License.
| DRACP ID | Peptide Name | Sequence | Sequence Length | Origin |
|---|---|---|---|---|
| DRACP05101 | Ala48 substitution mutant of pAntp (43-58) | RQIKIAFQNRRMKWKK | 16 | Protein derived |
| DRACP05102 | Ala49 substitution mutant of pAntp (43-58) | RQIKIWAQNRRMKWKK | 16 | Protein derived |
| DRACP05103 | Ala50 substitution mutant of pAntp (43-58) | RQIKIWFANRRMKWKK | 16 | Protein derived |
| DRACP05104 | Ala51 substitution mutant of pAntp (43-58) | RQIKIWFQARRMKWKK | 16 | Protein derived |
| DRACP05105 | Ala52 substitution mutant of pAntp (43-58) | RQIKIWFQNARMKWKK | 16 | Protein derived |
| DRACP05106 | Ala53 substitution mutant of pAntp (43-58) | RQIKIWFQNRAMKWKK | 16 | Protein derived |
| DRACP05107 | Ala54 substitution mutant of pAntp (43-58) | RQIKIWFQNRRAKWKK | 16 | Protein derived |
| DRACP05108 | Ala55 substitution mutant of pAntp (43-58) | RQIKIWFQNRRMAWKK | 16 | Protein derived |
| DRACP05109 | Ala56 substitution mutant of pAntp (43-58) | RQIKIWFQNRRMKAKK | 16 | Protein derived |
| DRACP05110 | Ala57 substitution mutant of pAntp (43-58) | RQIKIWFQNRRMKWAK | 16 | Protein derived |
| DRACP05111 | Ala58 substitution mutant of pAntp (43-58) | RQIKIWFQNRRMKWKA | 16 | Protein derived |
| DRACP05112 | Reduced linear penetratin | CRQIKIWFPNRRMKWKKC | 18 | Protein derived |
| DRACP05113 | Penetratin (pAntp) (43-58) | RQIKIWFPNRRMKWKK | 16 | Protein derived |
| DRACP05114 | DPV3 | RKKRRRESRKKRRRES | 16 | Protein derived |
| DRACP05115 | DPV6 | GRPRESGKKRKRKRLKP | 17 | Protein derived |
| DRACP05116 | DPV7 | GKRKKKGKLGKKRDP | 15 | Protein derived |
| DRACP05117 | DPV7b | GKRKKKGKLGKKRPRSR | 17 | Protein derived |
| DRACP05118 | DPV3/10 | RKKRRRESRRARRSPRHL | 18 | Protein derived |
| DRACP05119 | DPV10/6 | SRRARRSPRESGKKRKRKR | 19 | Protein derived |
| DRACP05120 | DPV1047 | VKRGLKLRHVRPRVTRMDV | 19 | Protein derived |
| DRACP05121 | DPV10 | SRRARRSPRHLGSG | 14 | Protein derived |
| DRACP05122 | DPV15 | LRRERQSRLRRERQSR | 16 | Protein derived |
| DRACP05123 | DPV15b | GAYDLRRRERQSRLRRRERQSR | 22 | Protein derived |
| DRACP05124 | Bip2 | VPTLK | 5 | Protein derived |
| DRACP05125 | Inv1, rMce1a (1-21) | VNADIKATTVFGGKYVSLTTP | 21 | Protein derived |
| DRACP05126 | Inv2, rMce1a (13-34) | GKYVSLTTPKNPTKRRITPKDV | 22 | Protein derived |
| DRACP05127 | Inv3, rMce1a (25-46) | TKRRITPKDVIDVRSVTTEINT | 22 | Protein derived |
| DRACP05128 | Inv4, rMce1a (38-60) | RSVTTEINTLFQTLTSIAEKVDP | 23 | Protein derived |
| DRACP05129 | Inv5, rMce1a (1-60) | VNADIKATTVFGGKYVSLTTPKNPTKRRITPKDVIDVRSVTTEINTLFQTLTSIAEKVDP | 60 | Protein derived |
| DRACP05130 | Inv6, rMce1a (56-80) | AEKVDPVKLNLTLSAAAEALTGLGDK | 26 | Protein derived |
This work is licensed under a Creative Commons Attribution 4.0 International License.