Peptide Libraray

HNP-3

General Information

DRACP ID DRACP00024

Peptide Name HNP-3

Sequence DCYCRIPACIAGERRYGTCIYQGRLWAFCC

Sequence Length 30

UniProt ID P59665 Q6EZE9

PubChem CID Not available

Origin Human alpha-defensins

Type Native peptide

Classification

Active ACP Membrane-targeted

Activity Information

Cell Line	Disease	Cancer Classified	Activity	Assay	Testing Time	Literature
RCCs (A-498, Caki-2, 786-0, 769-P, ACHN, LE 9211-RCC, TW33, N43)	Renal Cell Carcinoma	Carcinoma	At higher concentrations than 25 μg/ml, HNPs-1, -2, and -3 exerted cytotoxic effects on all tested RCC lines in an in vitro serum-free culture system (at lower concentrations they stimulated cell grow	WST-1 assay	40 h	1

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Nature Anticancer

Structure Information

PDB ID Not available

Predicted Structure DRACP00024

Helicity Not available

Linear/Cyclic Cyclic

Disulfide/Other Bond Cys2<--->Cys30; Cys4<--->Cys19; Cys9<--->Cys29

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C151H228N44O40S6

Absent amino acids HKMNSV

Common amino acids C

Mass 400958

Pl 8.11

Basic residues 4

Acidic residues 2

Hydrophobic residues 9

Net charge 2

Boman Index -4282

Hydrophobicity 12.33

Aliphatic Index 62

Half Life
Mammalian: 1.2 hour
Yeast: >20 hour
E.coli: >10 hour

Extinction Coefficient cystines 10345

Absorbance 280nm 356.72

Polar residues 13

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 11943716

Title Human alpha-defensins HNPs-1, -2, and -3 in renal cell carcinoma: influences on tumor cell proliferation

Doi 10.1016/s0002-9440(10)62558-8

Year 2002

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available

External Code

CancerPPD ID 4432