HNP-3
General Information
DRACP ID DRACP00024
Peptide Name HNP-3
Sequence DCYCRIPACIAGERRYGTCIYQGRLWAFCC
Sequence Length 30
PubChem CID Not available
Origin Human alpha-defensins
Type Native peptide
Classification
Active ACP Membrane-targeted
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| RCCs (A-498, Caki-2, 786-0, 769-P, ACHN, LE 9211-RCC, TW33, N43) | Renal Cell Carcinoma | Carcinoma | At higher concentrations than 25 μg/ml, HNPs-1, -2, and -3 exerted cytotoxic effects on all tested RCC lines in an in vitro serum-free culture system (at lower concentrations they stimulated cell grow | WST-1 assay | 40 h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys2<--->Cys30; Cys4<--->Cys19; Cys9<--->Cys29
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C151H228N44O40S6
Absent amino acids HKMNSV
Common amino acids C
Mass 400958
Pl 8.11
Basic residues 4
Acidic residues 2
Hydrophobic residues 9
Net charge 2
Boman Index -4282
Hydrophobicity 12.33
Aliphatic Index 62
Half Life
Mammalian: 1.2 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 10345
Absorbance 280nm 356.72
Polar residues 13
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 11943716
Title Human alpha-defensins HNPs-1, -2, and -3 in renal cell carcinoma: influences on tumor cell proliferation
Doi 10.1016/s0002-9440(10)62558-8
Year 2002
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
CancerPPD ID 4432