This work is licensed under a Creative Commons Attribution 4.0 International License.
Ligatoxin-B
General Information
DRACP ID DRACP00047
Peptide Name Ligatoxin-B
Sequence KSCCPSTTARNIYNTCRLTGASRSVCASLSGCKIISGSTCDSGWNH
Sequence Length 46
UniProt ID Not available
PubChem CID Not available
Origin Phoradendron liga
Type Native peptide
Classification
Active ACP Membrane-targeted
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| U-937/GTB | Adult acute monocytic leukemia; Acute monoblastic/monocytic leukemia | Leukemia | IC50=1.8 µM | FMCA assay | 72h | 1 |
| ACHN | Papillary renal cell carcinoma | Carcinoma | IC50=3.2 µM | FMCA assay | 72h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys3<--->Cys40; Cys4<--->Cys32; Cys16<---Cys26
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C194H319N63O67S6
Absent amino acids EFMQ
Common amino acids S
Mass 560124
Pl 8.63
Basic residues 6
Acidic residues 1
Hydrophobic residues 10
Net charge 5
Boman Index -8491
Hydrophobicity -19.35
Aliphatic Index 55.22
Half Life
Mammalian: 1.3 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 7365
Absorbance 280nm 163.67
Polar residues 28
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 12049612
Title Ligatoxin B, a new cytotoxic protein with a novel helix-turn-helix DNA-binding domain from the mistletoe Phoradendron liga
Year 2002
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.