FIV-NCSU1 HR2 T1971 (733-767)
General Information
DRACP ID DRACP00050
Peptide Name FIV-NCSU1 HR2 T1971 (733-767)
Sequence GEWYNQTKDLQQKFYEIIMDIEQNNVQGKKGIQQL
Sequence Length 35
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP Membrane-targeted
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| HeLa | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | no cytotoxic effects up to 23 μM | XTT assay | 24h | 1 |
Hemolytic Activity Human erythrocytes: Not active up to 1024 µg/ml
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antiviral
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Acetylation
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C188H292N50O59S
Absent amino acids ACHPRS
Common amino acids Q
Mass 483541
Pl 4.67
Basic residues 4
Acidic residues 5
Hydrophobic residues 9
Net charge -1
Boman Index -7758
Hydrophobicity -111.43
Aliphatic Index 75.14
Half Life
Mammalian: 1 hour
Yeast: 30 min
E.coli: >10 hour
Extinction Coefficient cystines 8480
Absorbance 280nm 249.41
Polar residues 9
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 12186891
Title C-Terminal gp40 peptide analogs inhibit feline immunodeficiency virus: cell fusion and virus spread
Doi 10.1128/jvi.76.18.9079-9086.2002
Year 2002
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available