This work is licensed under a Creative Commons Attribution 4.0 International License.
Dermaseptin-L1
General Information
DRACP ID DRACP00185
Peptide Name Dermaseptin-L1
Sequence GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS
Sequence Length 32
UniProt ID Not available
PubChem CID Not available
Origin skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae)
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| Hep-G2 | Hepatoblastoma; Hepatoblastoma | Blastoma | LC50=45 μM | Cytolytic assays | 1 h | 1 |
Hemolytic Activity Human erythrocytes: LC50=40 μM
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Cytolytic
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C140H233N41O44
Absent amino acids CFHMRY
Common amino acids A
Mass 374780
Pl 10.33
Basic residues 4
Acidic residues 2
Hydrophobic residues 14
Net charge 2
Boman Index -2494
Hydrophobicity -19.06
Aliphatic Index 88.75
Half Life
Mammalian:
Yeast:
E.coli:
Extinction Coefficient cystines 5500
Absorbance 280nm 177.42
Polar residues 9
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 17561225
Title Peptides with differential cytolytic activity from skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae)
Doi 10.1016/j.toxicon.2007.04.017
Year 2007
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.