This work is licensed under a Creative Commons Attribution 4.0 International License.
vibi G
General Information
DRACP ID DRACP00188
Peptide Name vibi G
Sequence GTFPCGESCVFIPCLTSAIGCSCKSKVCYKN
Sequence Length 31
UniProt ID P85245
PubChem CID Not available
Origin V. biflora
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| U-937 | Adult acute monocytic leukemi; Acute monoblastic/monocytic leukemia | Leukemia | IC50=0.96 μM | Fluorometric microculture cytotoxicity assay | 72 h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C139H221N35O42S6
Absent amino acids DHMQRW
Common amino acids C
Mass 378214
Pl 8.11
Basic residues 3
Acidic residues 1
Hydrophobic residues 8
Net charge 2
Boman Index -787
Hydrophobicity 47.1
Aliphatic Index 59.68
Half Life
Mammalian: 1 hour
Yeast: 2 min
E.coli: 2 min
Extinction Coefficient cystines 1865
Absorbance 280nm 62.17
Polar residues 17
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 18191970
Title The alpine violet, Viola biflora, is a rich source of cyclotides with potent cytotoxicity
Doi 10.1016/j.phytochem.2007.10.023
Year 2008
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.