This work is licensed under a Creative Commons Attribution 4.0 International License.
vibi E
General Information
DRACP ID DRACP00190
Peptide Name vibi E
Sequence GIPCAESCVWIPCTVTALIGCGCSNKVCYN
Sequence Length 30
UniProt ID B1NRQ8
PubChem CID Not available
Origin V. biflora
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| U-937 | Adult acute monocytic leukemi; Acute monoblastic/monocytic leukemia | Leukemia | IC50=3.2 μM | Fluorometric microculture cytotoxicity assay | 72 h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C132H210N34O40S6
Absent amino acids DFHMQR
Common amino acids C
Mass 362316
Pl 5.94
Basic residues 1
Acidic residues 1
Hydrophobic residues 10
Net charge 0
Boman Index 1053
Hydrophobicity 81.67
Aliphatic Index 87.67
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 7365
Absorbance 280nm 253.97
Polar residues 16
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 18191970
Title The alpine violet, Viola biflora, is a rich source of cyclotides with potent cytotoxicity
Doi 10.1016/j.phytochem.2007.10.023
Year 2008
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.