This work is licensed under a Creative Commons Attribution 4.0 International License.
Cecropin A
General Information
DRACP ID DRACP00192
Peptide Name Cecropin A
Sequence KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK
Sequence Length 37
UniProt ID P01507
PubChem CID Not available
Origin Hyalophora Cecropia(silkmoth)
Type Native peptide
Classification
Active ACP Membrane-targeted
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| 486P | Bladder carcinoma | Carcinoma | IC50=251.47 µg/ml | WST-1 assay | 48 h | 1 |
| 486P | Bladder carcinoma | Carcinoma | IC50=69.2 µg/ml | BrdU assay | 48 h | 1 |
| 486P | Bladder carcinoma | Carcinoma | IC50=373.3/ µg/ml | LDH leakage assay | 48 h | 1 |
| RT-4 | Bladder carcinoma | Carcinoma | IC50=231.26 µg/ml | WST-1 assay | 48 h | 1 |
| RT-4 | Bladder carcinoma | Carcinoma | IC50=96.22 µg/ml | BrdU assay | 48 h | 1 |
| RT-4 | Bladder carcinoma | Carcinoma | IC50=289.3 µg/ml | LDH leakage assay | 48 h | 1 |
| 647V | Bladder carcinoma | Carcinoma | IC50=185.39 µg/ml | WST-1 assay | 48 h | 1 |
| 647V | Bladder carcinoma | Carcinoma | IC50=28.74 µg/ml | BrdU assay | 48 h | 1 |
| 647V | Bladder carcinoma | Carcinoma | IC50=200.7 µg/ml | LDH leakage assay | 48 h | 1 |
| J82 | Bladder carcinoma | Carcinoma | IC50=212.07 µg/ml | WST-1 assay | 48 h | 1 |
| J82 | Bladder carcinoma | Carcinoma | IC50=99.01 µg/ml | BrdU assay | 48 h | 1 |
| J82 | Bladder carcinoma | Carcinoma | IC50=319.2 µg/ml | LDH leakage assay | 48 h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Normal murine or human fibroblasts: low cytotoxic
Target Not available
Affinity Not available
Mechanism Cecropin A and B inhibit bladder cancer cell proliferation and viability in a dose-dependent fashion
Nature Anticancer; Antimicrobial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C184H312N52O47
Absent amino acids CHMSY
Common amino acids K
Mass 464717
Pl 11.18
Basic residues 8
Acidic residues 2
Hydrophobic residues 17
Net charge 6
Boman Index -3133
Hydrophobicity -7.3
Aliphatic Index 108.11
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 5500
Absorbance 280nm 152.78
Polar residues 6
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 18315881
Title Antimicrobial peptides of the Cecropin-family show potent antitumor activity against bladder cancer cells
Year 2008
Literature 2
Pubmed ID 6579533
Title Solid-phase synthesis of cecropin A and related peptides
Year 1983
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPR_571 DBAASPR_571
This work is licensed under a Creative Commons Attribution 4.0 International License.