Cecropin B
General Information
DRACP ID DRACP00193
Peptide Name Cecropin B
Sequence KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL
Sequence Length 35
UniProt ID P01508
PubChem CID 16130488
Origin Chinese oak silk moth
Type Native peptide
Classification
Active ACP Membrane-targeted
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| 486P | Bladder carcinoma | Carcinoma | IC50=161.76 µg/ml | WST-1 assay | 48 h | 1 |
| J82 | Bladder carcinoma | Carcinoma | IC50=97.93 µg/ml | WST-1 assay | 48 h | 1 |
| 486P | Bladder carcinoma | Carcinoma | IC50=87.47 µg/ml | Cell Viability assay | 48 h | 1 |
| J82 | Bladder carcinoma | Carcinoma | IC50=77.51 µg/ml | Cell Viability assay | 48 h | 1 |
| 486P | Bladder carcinoma | Carcinoma | IC50=232.4 µg/ml | LDH leakage assay | 48 h | 1 |
| J82 | Bladder carcinoma | Carcinoma | Cytotoxicity=196.3 µg/ml | LDH leakage assay | 48 h | 1 |
| RT-4 | Bladder carcinoma | Carcinoma | IC50=184.81 µg/ml | WST-1 assay | 48 h | 1 |
| RT-4 | Bladder carcinoma | Carcinoma | IC50=92.9 µg/ml | Cell Viability assay | 48 h | 1 |
| RT-4 | Bladder carcinoma | Carcinoma | IC50=240.4 µg/ml | LDH leakage assay | 48 h | 1 |
| 647V | Bladder carcinoma | Carcinoma | IC50=115.12 µg/ml | WST-1 assay | 48 h | 1 |
| 647V | Bladder carcinoma | Carcinoma | IC50=61.86 µg/ml | Cell Viability assay | 48 h | 1 |
| 647V | Bladder carcinoma | Carcinoma | IC50=181.1 µg/ml | LDH leakage assay | 48 h | 1 |
| K562 | Blast phase chronic myelogenous leukemia, BCR-ABL1 positive; Chronic myeloid leukemia | Leukemia | IC50=15.5 µM | MTT assay | 96 h | 3 |
| BTS-30 | Breast Cancer | Carcinoma | IC50=24.8 µM | MTT assay | 96 h | 3 |
| HRT-18 | Colon adenocarcinoma | Carcinoma | IC50=25.5 µM | MTT assay | 96 h | 3 |
| DLD-1 | Colon adenocarcinoma | Carcinoma | IC50>100 µM | MTT assay | 96 h | 3 |
| WEHI-3B | Mouse leukemia | Leukemia | IC50=4.4 µM | MTT assay | 96 h | 3 |
| A2780 | Ovarian endometrioid adenocarcinoma; Endometrioid carcinoma of ovary | Carcinoma | IC50=30.6 µM | MTT assay | 96 h | 3 |
| HCLO | Colon adenocarcinoma | Carcinoma | IC50=33.5 µM | MTT assay | 96 h | 3 |
| CHO-K1 | Ovary tumor | Carcinoma | IC50=32 µM | MTT assay | 96 h | 3 |
| MAC 15A | Mouse colon adenocarcinoma | Carcinoma | IC50=37 µM | MTT assay | 96 h | 3 |
| MCF-7 | Invasive breast carcinoma of no special type | Carcinoma | IC50=42.5 µM | MTT assay | 96 h | 3 |
| HT-29 | Colon adenocarcinoma | Carcinoma | IC50>100 µM | MTT assay | 96 h | 3 |
| A2780 | Ovarian endometrioid adenocarcinoma; Endometrioid carcinoma of ovary | Carcinoma | IC50=34.5 µM | MTT assay | 96 h | 3 |
| MCF-7R | Invasive breast carcinoma of no special type | Carcinoma | IC50=24.5 µM | MTT assay | 96 h | 3 |
| AGS | Gastric adenocarcinoma | Carcinoma | IC50>50 µM | MTT assay | 48 h | 4 |
| HL-60 | Adult acute myeloid leukemia; Acute myeloid leukemia | Leukemia | IC50=18.5±1.7 µM | MTT assay | 48 h | 4 |
| CCRF-CEM | Childhood T acute lymphoblastic leukemia; Precursor T-cell acute lymphoblastic leukemia | Leukemia | IC50=11.7±1.3 µM | MTT assay | 48 h | 4 |
| NCI-H520 | Lung squamous cell carcinoma | Carcinoma | IC50=58.8±2.0 µM | MTT assay | 48 h | 4 |
| NCI-H661 | Lung squamous cell carcinoma | Carcinoma | IC50>100 µM | MTT assay | 48 h | 4 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Normal murine or human fibroblasts: low cytotoxic
Target Not available
Affinity Not available
Mechanism Cecropin A and B inhibit bladder cancer cell proliferation and viability in a dose-dependent fashion
Nature Anticancer; Antimicrobial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C176H301N51O42S
Absent amino acids CDHQSTY
Common amino acids K
Mass 444236
Pl 11.49
Basic residues 9
Acidic residues 2
Hydrophobic residues 16
Net charge 7
Boman Index -3348
Hydrophobicity -7.14
Aliphatic Index 106
Half Life
Mammalian: 1.3 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 5500
Absorbance 280nm 161.76
Polar residues 6
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 18315881
Title Antimicrobial peptides of the Cecropin-family show potent antitumor activity against bladder cancer cells
Year 2008
Literature 2
Pubmed ID 3857578
Title Molecular cloning, cDNA sequencing, and chemical synthesis of cecropin B from Hyalophora cecropia
Year 3857578
Literature 3
Pubmed ID 7849420
Title Preliminary experimental anticancer activity of cecropins
Doi Not available
Year 1994
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPR_573