This work is licensed under a Creative Commons Attribution 4.0 International License.
BBI(Bowman-Birk type proteinase inhibitor)
General Information
DRACP ID DRACP00228
Peptide Name BBI(Bowman-Birk type proteinase inhibitor)
Sequence DDESSKPCCDQCACTKSNPPQCRCSDMRLNSCHSACKSCICALSYPAQCFCVDITDFCYEPCKPSEDDKEN
Sequence Length 71
UniProt ID Not available
PubChem CID Not available
Origin Glycine max
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| HT-29 | Colon adenocarcinoma | Carcinoma | IC50=48.3±3.5µM | NR uptake assay | 24-96h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys8<--->Cys62; Cys9<--->Cys24; Cys12<--->Cys58; Cys14<--->Cys22; Cys32<--->Cys39; Cys36<--->Cys51; Cys41<--->Cys49
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C316H492N90O115S15
Absent amino acids GW
Common amino acids C
Mass 912161
Pl 4.3
Basic residues 8
Acidic residues 12
Hydrophobic residues 11
Net charge -4
Boman Index -17462
Hydrophobicity -63.38
Aliphatic Index 31.69
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 3855
Absorbance 280nm 55.07
Polar residues 30
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 19885848
Title The cytotoxic effect of Bowman-Birk isoinhibitors, IBB1 and IBBD2, from soybean (Glycine max) on HT29 human colorectal cancer cells is related to their intrinsic ability to inhibit serine proteases
Year 2010
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.