This work is licensed under a Creative Commons Attribution 4.0 International License.
Ceropin
General Information
DRACP ID DRACP00232
Peptide Name Ceropin
Sequence MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG
Sequence Length 63
UniProt ID Not available
PubChem CID Not available
Origin Musca domestica
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| BEL-7402 | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | 91.8% Cell viability at 12.5 µM | Trypan blue assay | 48 h | 1 |
| BEL-7402 | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | 84.1% Cell viability at 25 µM | Trypan blue assay | 48 h | 1 |
| BEL-7402 | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | 76.3% Cell viability at 50 µM | Trypan blue assay | 48 h | 1 |
| BEL-7402 | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | 71.5 % Cell viability at 75 µM | Trypan blue assay | 48 h | 1 |
| BEL-7402 | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | 54.2 % Cell viability at 100 µM | Trypan blue assay | 48 h | 1 |
| BEL-7402 | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | 87.3 % Cell viability at 25 µM | Trypan blue assay | 48 h | 1 |
| BEL-7402 | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | 75.6 % Cell viability at 50 µM | Trypan blue assay | 48 h | 1 |
| BEL-7402 | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | 62.8 % Cell viability at 75 µM | Trypan blue assay | 48 h | 1 |
| BEL-7402 | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | 54.3 % Cell viability at 100 µM | Trypan blue assay | 48 h | 1 |
| BEL-7402 | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | 48.6 % Cell viability at 100 µM | Trypan blue assay | 48 h | 1 |
| BEL-7402 | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | 72.1 % Cell viability at 12.5 µM | Trypan blue assay | 48 h | 1 |
| BEL-7402 | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | 63.3 % Cell viability at 25 µM | Trypan blue assay | 48 h | 1 |
| BEL-7402 | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | 49.7 % Cell viability at 50 µM | Trypan blue assay | 48 h | 1 |
| BEL-7402 | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | 41.1 % Cell viability at 75 µM | Trypan blue assay | 48 h | 1 |
| BEL-7402 | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | 35.2 % Cell viability at 100 µM | Trypan blue assay | 48 h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism cecropin can induce apoptosis of the human hepatoma BEL-7402 cells, which might be associated with up-regulation of Fas, Fas-L, caspase-8, and caspase-3
Nature Anticancer; Antimicrobial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C304H502N86O83S2
Absent amino acids PY
Common amino acids A
Mass 786011
Pl 10.79
Basic residues 9
Acidic residues 3
Hydrophobic residues 30
Net charge 6
Boman Index -3713
Hydrophobicity 30
Aliphatic Index 108.41
Half Life
Mammalian: 1.3 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 5500
Absorbance 280nm 88.71
Polar residues 15
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 20383464
Title Apoptosis-inducing activity of the antimicrobial peptide cecropin of Musca domestica in human hepatocellular carcinoma cell line BEL-7402 and the possible mechanism
Year 2010
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.