Psyle E
General Information
DRACP ID DRACP00237
Peptide Name Psyle E
Sequence GVIPCGESCVFIPCISSVLGCSCKNKVCYRD
Sequence Length 31
UniProt ID Not available
PubChem CID Not available
Origin Micronesian Plant Psychotria leptothyrsa
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| U-937 | Adult acute monocytic leukemi; Acute monoblastic/monocytic leukemia | Leukemia | IC50=0.76 μM | Nonclonogenic fluorometric microculture cytotoxicity assay | 72 h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C139H227N37O42S6
Absent amino acids AHMQTW
Common amino acids C
Mass 381621
Pl 7.73
Basic residues 3
Acidic residues 2
Hydrophobic residues 9
Net charge 1
Boman Index -1261
Hydrophobicity 65.16
Aliphatic Index 87.74
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 1865
Absorbance 280nm 62.17
Polar residues 15
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 20575512
Title Isolation, characterization, and bioactivity of cyclotides from the Micronesian plant Psychotria leptothyrsa
Year 2010
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available