Cliotides T4, CT4

General Information


DRACP ID  DRACP00285

Peptide Name   Cliotides T4, CT4

Sequence  GIPCGESCVFIPCITAAIGCSCKSKVCYRN

Sequence Length  30

UniProt ID  G1CWH3  P86902 

PubChem CID  Not available

Origin  Clitoria ternatea

Type  Native peptide

Classification

  

Active ACP



Activity Information


Cell Line Disease Cancer Classified Activity Assay Testing Time Literature
HeLa Human papillomavirus-related endocervical adenocarcinoma Carcinoma IC50=0.6 μM MTT assay 72 h 1
A549 Lung adenocarcinoma Carcinoma IC50=0.21 µM MTT assay 72 h 2

Hemolytic Activity  Human red blood cells: HD50=0.6 μM

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

Nature  Anticancer; Antibacterial



Structure Information


PDB ID  Not available

Predicted Structure  DRACP00285

Helicity  Not available

Linear/Cyclic  Cyclic

Disulfide/Other Bond  Cys4<--->Cys20; Cys8<--->Cys22; Cys13<--->Cys27; NCB: Gly1<--->Asn30

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C132H216N36O39S6

Absent amino acids  DHLMQW

Common amino acids  C

Mass  364121

Pl  8.11

Basic residues  3

Acidic residues  1

Hydrophobic residues  9

Net charge  2

Boman Index  -752

Hydrophobicity  65.67

Aliphatic Index  78

Half Life 
  Mammalian: 30 hour
  Yeast: >20 hour
  E.coli: >10 hour

Extinction Coefficient cystines  1865

Absorbance 280nm  64.31

Polar residues  15

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 21596752

Title  Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family

Doi 10.1074/jbc.M111.229922

Year  2011

Literature 2

Pubmed ID 23419988

Title  Chemosensitizing activities of cyclotides from Clitoria ternatea in paclitaxel-resistant lung cancer cells

Doi 10.3892/ol.2012.1042

Year  2013

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  DBAASPR_4278

DRACP is developed by Dr.Zheng's team.