This work is licensed under a Creative Commons Attribution 4.0 International License.
Cliotides T1, CT1
General Information
DRACP ID DRACP00286
Peptide Name Cliotides T1, CT1
Sequence GIPCGESCVFIPCITGAIGCSCKSKVCYRN
Sequence Length 30
UniProt ID G1CWH0
PubChem CID Not available
Origin Clitoria ternatea
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| HeLa | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | IC50=0.6 μM | MTT assay | 72 h | 1 |
Hemolytic Activity Human red blood cells: HD50=0.6 μM
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys4<--->Cys20; Cys8<--->Cys22; Cys13<--->Cys27; NCB: Gly1<--->Asn30
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C131H214N36O39S6
Absent amino acids DHLMQW
Common amino acids C
Mass 362718
Pl 8.11
Basic residues 3
Acidic residues 1
Hydrophobic residues 8
Net charge 2
Boman Index -839
Hydrophobicity 58.33
Aliphatic Index 74.67
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 1865
Absorbance 280nm 64.31
Polar residues 16
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 21596752
Title Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family
Year 2011
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPR_4276
This work is licensed under a Creative Commons Attribution 4.0 International License.