This work is licensed under a Creative Commons Attribution 4.0 International License.
Viphi A
General Information
DRACP ID DRACP00288
Peptide Name Viphi A
Sequence GSIPCGESCVFIPCISSVIGCACKSKVCYKN
Sequence Length 31
UniProt ID Not available
PubChem CID Not available
Origin Viola philippica
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| MM96L | Melanoma | Carcinoma | IC50=4.91±0.04µM | MTT assay | 5h | 1 |
| HeLa | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | IC50=15.5±0.06µM | MTT assay | 5h | 1 |
| BGC-823 | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | IC50=1.75±0.05µM | SRB assay | 48h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity HFF-1: IC50=3.19±0.01µM
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys5<--->Cys21; Cys9<--->Cys23; Cys14<--->Cys28
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C136H223N35O41S6
Absent amino acids DHLMQRTW
Common amino acids C
Mass 373213
Pl 8.11
Basic residues 3
Acidic residues 1
Hydrophobic residues 9
Net charge 2
Boman Index -15
Hydrophobicity 70.32
Aliphatic Index 81.61
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 1865
Absorbance 280nm 62.17
Polar residues 16
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 21723349
Title Isolation and characterization of cytotoxic cyclotides from Viola philippica
Doi 10.1016/j.peptides.2011.06.016
Year 2011
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPR_4487
This work is licensed under a Creative Commons Attribution 4.0 International License.