Viphi G

General Information


DRACP ID  DRACP00293

Peptide Name   Viphi G

Sequence  GSIPCGESCVFIPCISAIIGCSCSNKVCYKN

Sequence Length  31

UniProt ID  Not available

PubChem CID  Not available

Origin  Viola philippica

Type  Native peptide

Classification

  

Active ACP



Activity Information


Cell Line Disease Cancer Classified Activity Assay Testing Time Literature
MM96L Melanoma Carcinoma IC50=1.03±0.03µM MTT assay 5h 1
HeLa Human papillomavirus-related endocervical adenocarcinoma Carcinoma IC50=6.35±0.31µM MTT assay 5h 1
BGC-823 Human papillomavirus-related endocervical adenocarcinoma Carcinoma IC50=2.91±0.06µM SRB assay 48h 1

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  HFF-1: IC50=1.76±0.12µM

Target  Not available

Affinity  Not available

Mechanism  Not available

Nature  Anticancer



Structure Information


PDB ID  Not available

Predicted Structure  DRACP00293

Helicity  Not available

Linear/Cyclic  Cyclic

Disulfide/Other Bond  Cys5<--->Cys21; Cys9<--->Cys23; Cys14<--->Cys28

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C135H219N35O42S6

Absent amino acids  DHLMQRTW

Common amino acids  C

Mass  373209

Pl  7.73

Basic residues  2

Acidic residues  1

Hydrophobic residues  9

Net charge  1

Boman Index  -36

Hydrophobicity  72.58

Aliphatic Index  84.84

Half Life 
  Mammalian: 30 hour
  Yeast: >20 hour
  E.coli: >10 hour

Extinction Coefficient cystines  1865

Absorbance 280nm  62.17

Polar residues  17

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 21723349

Title  Isolation and characterization of cytotoxic cyclotides from Viola philippica

Doi 10.1016/j.peptides.2011.06.016

Year  2011

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  DBAASPR_4491

DRACP is developed by Dr.Zheng's team.