Pardaxin
General Information
DRACP ID DRACP00334
Peptide Name Pardaxin
Sequence GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE
Sequence Length 33
UniProt ID P81861
PubChem CID Not available
Origin Red Sea Mosessole
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| HT-1080 | Fibrosarcoma | Sarcoma | IC50=15.74 µg/ml | MTS assay | 3 h | 1 |
| HT-1080 | Fibrosarcoma | Sarcoma | IC50=15.40 µg/ml | MTS assay | 6 h | 1 |
| HT-1080 | Fibrosarcoma | Sarcoma | IC50=14.51 µg/ml | MTS assay | 12 h | 1 |
| HT-1080 | Fibrosarcoma | Sarcoma | IC50=14.52 µg/ml | MTS assay | 24 h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism pardaxin disrupted mitochondrial function and caused an accumulation of ROS that activated a caspase-dependent intrinsic apoptotic pathway
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C154H248N36O45
Absent amino acids CDHMNRWY
Common amino acids S
Mass 389483
Pl 9.54
Basic residues 2
Acidic residues 1
Hydrophobic residues 15
Net charge 1
Boman Index 1171
Hydrophobicity 74.55
Aliphatic Index 112.42
Half Life
Mammalian: 1.3 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 0
Absorbance 280nm 0
Polar residues 12
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 22073006
Title Pardaxin, an antimicrobial peptide, triggers caspase-dependent and ROS-mediated apoptosis in HT-1080 cells
Year 2011
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available