Peptide Libraray

Pardaxin

General Information

DRACP ID DRACP00334

Peptide Name Pardaxin

Sequence GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE

Sequence Length 33

UniProt ID P81861

PubChem CID Not available

Origin Red Sea Mosessole

Type Native peptide

Classification

Active ACP

Activity Information

Cell Line	Disease	Cancer Classified	Activity	Assay	Testing Time	Literature
HT-1080	Fibrosarcoma	Sarcoma	IC50=15.74 µg/ml	MTS assay	3 h	1
HT-1080	Fibrosarcoma	Sarcoma	IC50=15.40 µg/ml	MTS assay	6 h	1
HT-1080	Fibrosarcoma	Sarcoma	IC50=14.51 µg/ml	MTS assay	12 h	1
HT-1080	Fibrosarcoma	Sarcoma	IC50=14.52 µg/ml	MTS assay	24 h	1

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism pardaxin disrupted mitochondrial function and caused an accumulation of ROS that activated a caspase-dependent intrinsic apoptotic pathway

Nature Anticancer; Antibacterial

Structure Information

PDB ID 1XC0

Predicted Structure DRACP00334

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C154H248N36O45

Absent amino acids CDHMNRWY

Common amino acids S

Mass 389483

Pl 9.54

Basic residues 2

Acidic residues 1

Hydrophobic residues 15

Net charge 1

Boman Index 1171

Hydrophobicity 74.55

Aliphatic Index 112.42

Half Life
Mammalian: 1.3 hour
Yeast: 3 min
E.coli: 2 min

Extinction Coefficient cystines 0

Absorbance 280nm 0

Polar residues 12

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 22073006

Title Pardaxin, an antimicrobial peptide, triggers caspase-dependent and ROS-mediated apoptosis in HT-1080 cells

Doi 10.3390/md9101995

Year 2011

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available