This work is licensed under a Creative Commons Attribution 4.0 International License.
Cecropin-B
General Information
DRACP ID DRACP00389
Peptide Name Cecropin-B
Sequence KWKIFKKIEKVGRNIRNGIIKAGPAVAVLGEAKAL
Sequence Length 35
UniProt ID P01509
PubChem CID Not available
Origin Antheraea pernyi (Chinese oak silk moth)
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| RAW 264.7 | Mouse macrophage leukemia cell | Leukemia | Not active up to 100 µM | CCK-8 assay | 1 day | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antimicrobial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C177H303N51O42
Absent amino acids CDHMQSTY
Common amino acids K
Mass 442433
Pl 11.49
Basic residues 9
Acidic residues 2
Hydrophobic residues 17
Net charge 7
Boman Index -3091
Hydrophobicity 0.29
Aliphatic Index 117.14
Half Life
Mammalian: 1 hour
Yeast: 2 min
E.coli: 2 min
Extinction Coefficient cystines 5500
Absorbance 280nm 161.76
Polar residues 6
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 30065898
Title A novel cecropin B-derived peptide with antibacterial and potential anti-inflammatory properties
Year 2018
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPR_572
This work is licensed under a Creative Commons Attribution 4.0 International License.