This work is licensed under a Creative Commons Attribution 4.0 International License.
Chassatide C2
General Information
DRACP ID DRACP00397
Peptide Name Chassatide C2
Sequence GIPCAESCVWIPCTITALMGCSCKNNVCYNN
Sequence Length 31
UniProt ID I0B6F2
PubChem CID Not available
Origin Chassalia chartacea
Type Native peptide
Classification
Active ACP Membrane-targeted
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| HeLa | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | IC50=2.4 μM | MTT assay | Not available | 1 |
Hemolytic Activity Human erythrocytes: HD50>25 μM
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys4<--->Cys21; Cys8<--->Cys23; Cys13<--->Cys28; NCB: Gly1<--->Asn31
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C138H219N37O43S7
Absent amino acids DFHQR
Common amino acids C
Mass 384421
Pl 5.94
Basic residues 1
Acidic residues 1
Hydrophobic residues 9
Net charge 0
Boman Index -538
Hydrophobicity 50.32
Aliphatic Index 75.48
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 7365
Absorbance 280nm 245.5
Polar residues 17
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 22467870
Title Novel cyclotides and uncyclotides with highly shortened precursors from Chassalia chartacea and effects of methionine oxidation on bioactivities
Year 2012
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPR_4283
This work is licensed under a Creative Commons Attribution 4.0 International License.