Cupiennin-1a
General Information
DRACP ID DRACP00450
Peptide Name Cupiennin-1a
Sequence GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME
Sequence Length 35
UniProt ID Not available
PubChem CID Not available
Origin Cupiennius salei
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| Raji | EBV-related Burkitt lymphoma; Burkitt lymphoma | Lymphoma | EC50=0.19 µM | Alamar blue assay | 72h | 1 |
| HL-60 | Adult acute myeloid leukemia; Acute myeloid leukemia | Leukemia | EC50=0.23 µM | Alamar blue assay | 72h | 1 |
| Molt-4 | Adult T acute lymphoblastic leukemia; Precursor T-cell acute lymphoblastic leukemia | Leukemia | EC50=0.33 µM | Alamar blue assay | 72h | 1 |
| THP-1 | Childhood acute monocytic leukemia; Acute monoblastic/monocytic leukemia | Leukemia | EC50=0.35 µM | Alamar blue assay | 72h | 1 |
| HeLa | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | EC50=0.15 µM | Alamar blue assay | 72h | 1 |
| Sup T1 | EC50=0.23 µM | Alamar blue assay | 72h | 1 |
Hemolytic Activity Human erythrocytes: 50% Hemolysis=7.8 µg/ml; 50% Cell death=23 µg/ml
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C176H289N47O44S
Absent amino acids CDHIPRSW
Common amino acids K
Mass 440624
Pl 11.05
Basic residues 8
Acidic residues 1
Hydrophobic residues 16
Net charge 7
Boman Index -2440
Hydrophobicity -13.14
Aliphatic Index 75.43
Half Life
Mammalian: 1.1 hour
Yeast: 3 min
E.coli: >10 hour
Extinction Coefficient cystines 1490
Absorbance 280nm 43.82
Polar residues 6
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 20140690
Title Cupiennin 1a exhibits a remarkably broad, non-stereospecific cytolytic activity on bacteria, protozoan parasites, insects, and human cancer cells
Year 2011
Literature 2
Pubmed ID 23523532
Title N-terminal aromatic residues closely impact the cytolytic activity of cupiennin 1a, a major spider venom peptide
Doi 10.1016/j.toxicon.2013.03.003
Year 2013
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available