This work is licensed under a Creative Commons Attribution 4.0 International License.
Pardaxin-1
General Information
DRACP ID DRACP00456
Peptide Name Pardaxin-1
Sequence GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE
Sequence Length 33
UniProt ID P81861
PubChem CID Not available
Origin Epinephelus nebulosus
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| HeLa | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | ~70% Cytotoxicity=25 mg/L | MTS assay | 6 h | 1 |
| HT-1080 | Fibrosarcoma | Sarcoma | ~90% Cytotoxicity=25 mg/L | MTS assay | 6 h | 1 |
Hemolytic Activity The HL50 values of Pardaxin-1 (about 100 mg/L) were much higher than those of EP-1 and EP-8
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antimicrobial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C154H248N36O45
Absent amino acids CDHMNRWY
Common amino acids S
Mass 389483
Pl 9.54
Basic residues 2
Acidic residues 1
Hydrophobic residues 15
Net charge 1
Boman Index 1171
Hydrophobicity 74.55
Aliphatic Index 112.42
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 0
Absorbance 280nm 0
Polar residues 12
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 23598079
Title Truncated antimicrobial peptides from marine organisms retain anticancer activity and antibacterial activity against multidrug-resistant Staphylococcus aureus
Doi 10.1016/j.peptides.2013.04.004
Year 2013
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.