This work is licensed under a Creative Commons Attribution 4.0 International License.
LL 37
General Information
DRACP ID DRACP00494
Peptide Name LL 37
Sequence [LL-37, 37 aa]
Sequence Length 37
PubChem CID Not available
Origin Also known human cathelicidin
Type Synthetic peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| MCF-7 | Invasive breast carcinoma of no special type | Carcinoma | LC50=21 at 100 µM | MTS assay | 72 h | 1 |
| LNCaP | Prostate carcinoma | Carcinoma | LC50=27 at 100 µM | MTS assay | 72 h | 1 |
| OVCAR-3 | High grade ovarian serous adenocarcinoma | Carcinoma | LC50=24 at 100 µM | MTS assay | 72 h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Primary dermal fibroblast: LC50=26 at 100 µM
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antimicrobial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C205H340N60O53
Absent amino acids ACHMWY
Common amino acids K
Mass 513561
Pl 11.35
Basic residues 11
Acidic residues 5
Hydrophobic residues 13
Net charge 6
Boman Index -11100
Hydrophobicity -72.43
Aliphatic Index 89.46
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 0
Absorbance 280nm 0
Polar residues 6
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 24587350
Title Learning from host-defense peptides: cationic, amphipathic peptoids with potent anticancer activity
Doi 10.1371/journal.pone.0090397
Year 2014
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
This work is licensed under a Creative Commons Attribution 4.0 International License.