This work is licensed under a Creative Commons Attribution 4.0 International License.
Toxin F-VIII
General Information
DRACP ID DRACP00507
Peptide Name Toxin F-VIII
Sequence MICYSHKTPQPSATITCEEKTCYKKSVRKLPAIVAGRGCGCPSKEMLVAIHCCRSDKCNE
Sequence Length 60
UniProt ID P01404
PubChem CID Not available
Origin venom of the Eastern green mamba, Dendroaspis angusticeps (Elapidae)
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| A549 | Lung adenocarcinoma | Carcinoma | LC50=106±5 μg/mL | CellTiter-Glo Lumines- cent Cell Viability assay | 24h | 1 |
| MDA-MB-231 | Breast adenocarcinoma | Carcinoma | LC50>300 μg/mL | CellTiter-Glo Lumines- cent Cell Viability assay | 24h | 1 |
| HT-29 | Colon adenocarcinoma | Carcinoma | LC50>300 μg/mL | CellTiter-Glo Lumines- cent Cell Viability assay | 24h | 1 |
Hemolytic Activity Human erythrocytes: LC50>1000 μg/mL
Normal (non-cancerous) Cytotoxicity HUVEC: LC50>300 μg/mL
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antitumor; Antimicrobial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C277H462N82O84S10
Absent amino acids FW
Common amino acids CK
Mass 765838
Pl 8.59
Basic residues 12
Acidic residues 5
Hydrophobic residues 13
Net charge 7
Boman Index -10199
Hydrophobicity -32.5
Aliphatic Index 60.17
Half Life
Mammalian: 1.3 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 3480
Absorbance 280nm 58.98
Polar residues 23
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 25035794
Title Peptides with in vitro anti-tumor activity from the venom of the Eastern green mamba, Dendroaspis angusticeps (Elapidae)
Doi Not available
Year 2014
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.