This work is licensed under a Creative Commons Attribution 4.0 International License.
Toxin C13S1C1
General Information
DRACP ID DRACP00508
Peptide Name Toxin C13S1C1
Sequence RICYSHKLLQAKTTKTCEENSCYKRSLPKIPLIIIGRGCGCPLTLPFLRIKCCTSDKCN
Sequence Length 59
UniProt ID P18329
PubChem CID Not available
Origin venom of the Eastern green mamba, Dendroaspis angusticeps (Elapidae)
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| HT-29 | Colon adenocarcinoma | Carcinoma | LC50=110±4 μg/mL | CellTiter-Glo Lumines- cent Cell Viability assay | 24h | 1 |
| A549 | Lung adenocarcinoma | Carcinoma | LC50=56±4 μg/mL | CellTiter-Glo Lumines- cent Cell Viability assay | 24h | 1 |
| MDA-MB-231 | Breast adenocarcinoma | Carcinoma | LC50=62±2 μg/mL | CellTiter-Glo Lumines- cent Cell Viability assay | 24h | 1 |
Hemolytic Activity Human erythrocytes: LC50>600 μg/mL
Normal (non-cancerous) Cytotoxicity HUVEC: LC50=57±3 μg/mL
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antitumor; Antimicrobial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C289H487N83O80S8
Absent amino acids MVW
Common amino acids CKL
Mass 769577
Pl 9.24
Basic residues 12
Acidic residues 3
Hydrophobic residues 15
Net charge 9
Boman Index -8927
Hydrophobicity -13.9
Aliphatic Index 87.63
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 3480
Absorbance 280nm 60
Polar residues 24
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 25035794
Title Peptides with in vitro anti-tumor activity from the venom of the Eastern green mamba, Dendroaspis angusticeps (Elapidae)
Doi Not available
Year 2014
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.