DC1

General Information


DRACP ID  DRACP00549

Peptide Name   DC1

Sequence  GAFLKCGESCVYLPCLTTVVGCSCQNSVCYRD

Sequence Length  32

UniProt ID  Not available

PubChem CID  Not available

Origin  Hedyotis diffusa

Type  Native peptide

Classification

  

Active ACP



Activity Information


Cell Line Disease Cancer Classified Activity Assay Testing Time Literature
LNCaP Prostate carcinoma Carcinoma IC50=5.03 μM CCK-8 assay 72h 1
PC-3 Prostate carcinoma Carcinoma IC50=2.24 μM CCK-8 assay 72h 1
DU145 Prostate carcinoma Carcinoma IC50=3.32 μM CCK-8 assay 72h 1

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  induce apoptosis and inhibit proliferation and migration of prostate cancer cells

Nature  Anticancer



Structure Information


PDB ID  Not available

Predicted Structure  DRACP00549

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C144H228N38O46S6

Absent amino acids  HIMW

Common amino acids  C

Mass  397312

Pl  6.02

Basic residues  2

Acidic residues  2

Hydrophobic residues  9

Net charge  0

Boman Index  -1759

Hydrophobicity  50.63

Aliphatic Index  75.94

Half Life 
  Mammalian: 1 hour
  Yeast: 2 min
  E.coli: 2 min

Extinction Coefficient cystines  3355

Absorbance 280nm  108.23

Polar residues  17

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 26064310

Title  Novel cyclotides from Hedyotis diffusa induce apoptosis and inhibit proliferation and migration of prostate cancer cells

Doi Not available

Year  2015

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DRACP is developed by Dr.Zheng's team.