This work is licensed under a Creative Commons Attribution 4.0 International License.
DC1
General Information
DRACP ID DRACP00549
Peptide Name DC1
Sequence GAFLKCGESCVYLPCLTTVVGCSCQNSVCYRD
Sequence Length 32
UniProt ID Not available
PubChem CID Not available
Origin Hedyotis diffusa
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| LNCaP | Prostate carcinoma | Carcinoma | IC50=5.03 μM | CCK-8 assay | 72h | 1 |
| PC-3 | Prostate carcinoma | Carcinoma | IC50=2.24 μM | CCK-8 assay | 72h | 1 |
| DU145 | Prostate carcinoma | Carcinoma | IC50=3.32 μM | CCK-8 assay | 72h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism induce apoptosis and inhibit proliferation and migration of prostate cancer cells
Nature Anticancer
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C144H228N38O46S6
Absent amino acids HIMW
Common amino acids C
Mass 397312
Pl 6.02
Basic residues 2
Acidic residues 2
Hydrophobic residues 9
Net charge 0
Boman Index -1759
Hydrophobicity 50.63
Aliphatic Index 75.94
Half Life
Mammalian: 1 hour
Yeast: 2 min
E.coli: 2 min
Extinction Coefficient cystines 3355
Absorbance 280nm 108.23
Polar residues 17
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 26064310
Title Novel cyclotides from Hedyotis diffusa induce apoptosis and inhibit proliferation and migration of prostate cancer cells
Doi Not available
Year 2015
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.