DC3
General Information
DRACP ID DRACP00551
Peptide Name DC3
Sequence GTSCGETCVLLPCLSSVLGCTCQNKRCYKD
Sequence Length 30
UniProt ID Not available
PubChem CID Not available
Origin Hedyotis diffusa
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| LNCaP | Prostate carcinoma | Carcinoma | IC50=0.21 μM | CCK-8 assay | 72h | 1 |
| PC-3 | Prostate carcinoma | Carcinoma | IC50=0.76 μM | CCK-8 assay | 72h | 1 |
| DU145 | Prostate carcinoma | Carcinoma | IC50=0.55 μM | CCK-8 assay | 72h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism induce apoptosis and inhibit proliferation and migration of prostate cancer cells
Nature Anticancer
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C129H217N37O44S6
Absent amino acids AFHIMW
Common amino acids C
Mass 370019
Pl 7.73
Basic residues 3
Acidic residues 2
Hydrophobic residues 6
Net charge 1
Boman Index -3352
Hydrophobicity 12.33
Aliphatic Index 71.33
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 1865
Absorbance 280nm 64.31
Polar residues 17
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 26064310
Title Novel cyclotides from Hedyotis diffusa induce apoptosis and inhibit proliferation and migration of prostate cancer cells
Doi Not available
Year 2015
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available