Defensin AFP1 / Hs-AFP1
General Information
DRACP ID DRACP00567
Peptide Name Defensin AFP1 / Hs-AFP1
Sequence DGVKLCDVPSGTWSGHCGSSSKCSQQCKDREHFAYGGACHYQFPSVKCFCKRQC
Sequence Length 54
UniProt ID Not available
PubChem CID Not available
Origin Heuchera sanguinea
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| HepG2 | Hepatoblastoma | Blastoma | Not active up to 40 µM | Cell Proliferation Kit II (XTT) assay | 24h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys6<--->Cys54; Cys17<--->Cys39; Cys23<--->Cys48; Cys27<--->Cys50
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C251H378N76O77S8
Absent amino acids IMN
Common amino acids CS
Mass 689425
Pl 8.21
Basic residues 10
Acidic residues 4
Hydrophobic residues 10
Net charge 6
Boman Index -10554
Hydrophobicity -61.3
Aliphatic Index 27.04
Half Life
Mammalian: 2.8 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 8980
Absorbance 280nm 169.43
Polar residues 24
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 26248029
Title Synergistic Activity of the Plant Defensin HsAFP1 and Caspofungin against Candida albicans Biofilms and Planktonic Cultures
Doi 10.1371/journal.pone.0132701
Year 2015
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available