This work is licensed under a Creative Commons Attribution 4.0 International License.
PaDef defensin
General Information
DRACP ID DRACP00603
Peptide Name PaDef defensin
Sequence ATCETPSKHFNGLCIRSSNCASVCHGEHFTDGRCQGVRRRCMCLKPC
Sequence Length 47
UniProt ID Not available
PubChem CID Not available
Origin Plant defensins
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| MCF-7 | Invasive breast carcinoma of no special type | Carcinoma | IC 50=141.62 μg/mL | Trypan blue assay | 48h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism PaDef defensin from avocado (Persea americana) fruit is cytotoxic to MCF-7 cells via the induction of mitochondrial apoptosis
Nature Anticancer
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C210H341N73O64S9
Absent amino acids WY
Common amino acids C
Mass 602169
Pl 8.42
Basic residues 10
Acidic residues 3
Hydrophobic residues 9
Net charge 7
Boman Index -11338
Hydrophobicity -41.28
Aliphatic Index 41.49
Half Life
Mammalian: 1.3 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 500
Absorbance 280nm 10.87
Polar residues 21
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 27470405
Title The defensin from avocado (Persea americana var. drymifolia) PaDef induces apoptosis in the human breast cancer cell line MCF-7
Doi 10.1016/j.biopha.2016.05.048
Year 2016
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.