Class I defensin, NaD2
General Information
DRACP ID DRACP00610
Peptide Name Class I defensin, NaD2
Sequence RTCESQSHRFKGPCARDSNCATVCLTEGFSGGDCRGFRRRCFCTRPC
Sequence Length 47
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
---|---|---|---|---|---|---|
U-937 | Adult acute monocytic leukemi; Acute monoblastic/monocytic leukemia | Leukemia | 5.9±1.3% Cell death=10 µM | PI uptake assay | 30min | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys23<--->Cys47; Cys14<---Cys34; Cys20<--->Cys41; Cys24<--->Cys43
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C212H338N76O66S8
Absent amino acids IMWY
Common amino acids CR
Mass 608462
Pl 8.61
Basic residues 10
Acidic residues 4
Hydrophobic residues 8
Net charge 6
Boman Index -15725
Hydrophobicity -69.15
Aliphatic Index 18.72
Half Life
Mammalian: 1 hour
Yeast: 2 min
E.coli: 2 min
Extinction Coefficient cystines 500
Absorbance 280nm 10.87
Polar residues 22
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 27503651
Title Nicotiana alata Defensin Chimeras Reveal Differences in the Mechanism of Fungal and Tumor Cell Killing and an Enhanced Antifungal Variant
Year 2016
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available