CecXJ-37N
General Information
DRACP ID DRACP00615
Peptide Name CecXJ-37N
Sequence RWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAIGK
Sequence Length 37
UniProt ID Not available
PubChem CID Not available
Origin Bombyx mori
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| Eca 109 | Esophageal squamous cell carcinoma; Squamous cell carcinoma of the esophagus | Carcinoma | 30% Killing=20µM | MTT assay | 24h | 1 |
Hemolytic Activity Human erythrocytes: 5% Hemolysis=134.6µg/ml
Normal (non-cancerous) Cytotoxicity NIH 3T3: Not active up to 20 µM
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C185H317N55O46S
Absent amino acids CHQTY
Common amino acids K
Mass 472228
Pl 11.46
Basic residues 10
Acidic residues 3
Hydrophobic residues 15
Net charge 7
Boman Index -5387
Hydrophobicity -24.32
Aliphatic Index 100.27
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 5500
Absorbance 280nm 152.78
Polar residues 7
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 27664674
Title A potential food biopreservative, CecXJ-37N, non-covalently intercalates into the nucleotides of bacterial genomic DNA beyond membrane attack
Doi 10.1016/j.foodchem.2016.09.033
Year 2017
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available