This work is licensed under a Creative Commons Attribution 4.0 International License.
Saha-CATH3
General Information
DRACP ID DRACP00620
Peptide Name Saha-CATH3
Sequence KRMGIFHLFWAGLRKLGNLIKNKIQQGIENFLG
Sequence Length 33
UniProt ID Not available
PubChem CID Not available
Origin Sarcophilus harrisii
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| A549 | Lung adenocarcinoma | Carcinoma | Not active up to 500 µg/ml | Alamar blue assay | 24h | 1 |
Hemolytic Activity Human erythrocytes:5% Hemolysis=1-500µg/ml
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C179H287N51O41S
Absent amino acids CDPSTVY
Common amino acids GL
Mass 441261
Pl 11.82
Basic residues 7
Acidic residues 1
Hydrophobic residues 14
Net charge 6
Boman Index -3010
Hydrophobicity -7.88
Aliphatic Index 109.39
Half Life
Mammalian: 1.3 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 5500
Absorbance 280nm 171.88
Polar residues 8
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 27725697
Title Cathelicidins in the Tasmanian devil (Sarcophilus harrisii)
Year 2016
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.