Saha-CATH3

General Information


DRACP ID  DRACP00620

Peptide Name   Saha-CATH3

Sequence  KRMGIFHLFWAGLRKLGNLIKNKIQQGIENFLG

Sequence Length  33

UniProt ID  Not available

PubChem CID  Not available

Origin  Sarcophilus harrisii

Type  Native peptide

Classification

  

Active ACP



Activity Information


Cell Line Disease Cancer Classified Activity Assay Testing Time Literature
A549 Lung adenocarcinoma Carcinoma Not active up to 500 µg/ml Alamar blue assay 24h 1

Hemolytic Activity  Human erythrocytes:5% Hemolysis=1-500µg/ml

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

Nature  Anticancer; Antibacterial; Antifungal



Structure Information


PDB ID  Not available

Predicted Structure  DRACP00620

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C179H287N51O41S

Absent amino acids  CDPSTVY

Common amino acids  GL

Mass  441261

Pl  11.82

Basic residues  7

Acidic residues  1

Hydrophobic residues  14

Net charge  6

Boman Index  -3010

Hydrophobicity  -7.88

Aliphatic Index  109.39

Half Life 
  Mammalian: 1.3 hour
  Yeast: 3 min
  E.coli: 2 min

Extinction Coefficient cystines  5500

Absorbance 280nm  171.88

Polar residues  8

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 27725697

Title  Cathelicidins in the Tasmanian devil (Sarcophilus harrisii)

Doi 10.1038/srep35019

Year  2016

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DRACP is developed by Dr.Zheng's team.