This work is licensed under a Creative Commons Attribution 4.0 International License.
Saha-CATH2
General Information
DRACP ID DRACP00621
Peptide Name Saha-CATH2
Sequence TFKRKNGSRKNGHRPGGYSLIALGNKKVLKAPYMESI
Sequence Length 37
UniProt ID Not available
PubChem CID Not available
Origin Sarcophilus harrisii
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| A549 | Lung adenocarcinoma | Carcinoma | Not active up to 500µg/ml | Alamar blue assay | 24h | 1 |
Hemolytic Activity Human erythrocytes:5% Hemolysis=1-500µg/ml
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C183H303N57O49S
Absent amino acids CDQW
Common amino acids K
Mass 476012
Pl 11.43
Basic residues 10
Acidic residues 1
Hydrophobic residues 9
Net charge 9
Boman Index -8021
Hydrophobicity -86.76
Aliphatic Index 65.95
Half Life
Mammalian: 1.3 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 2980
Absorbance 280nm 82.78
Polar residues 14
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 27725697
Title Cathelicidins in the Tasmanian devil (Sarcophilus harrisii)
Year 2016
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.