This work is licensed under a Creative Commons Attribution 4.0 International License.
ABP-dHC-CecropinA
General Information
DRACP ID DRACP00673
Peptide Name ABP-dHC-CecropinA
Sequence RWKIFKKIERVGQNVRDGIIKAGPAIQVLGTAKALGK
Sequence Length 37
UniProt ID P50720
PubChem CID Not available
Origin ABP-dHC-Cecropin A and its analog
Type Synthetic peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| K562 | Blast phase chronic myelogenous leukemia, BCR-ABL1 positive; Chronic myeloid leukemia | Leukemia | IC50=349.5 µM | MTT assay | 24h | 1 |
| U-937 | Adult acute monocytic leukemi; Acute monoblastic/monocytic leukemia | Leukemia | IC50=303.2 µM | MTT assay | 24h | 1 |
| THP-1 | Childhood acute monocytic leukemia; Acute monoblastic/monocytic leukemia | Leukemia | IC50=228.5 µM | MTT assay | 24h | 1 |
Hemolytic Activity Human red blood cells (hRBCs): only 3% hemolysis was observed at the concentration of 800 µM
Normal (non-cancerous) Cytotoxicity HEK-293, PBMCs: no cytotoxicity toward HEK-293 cells or PBMCs, even at the highest concentration of 640 µM.
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C185H316N56O46
Absent amino acids CHMSY
Common amino acids K
Mass 470323
Pl 11.82
Basic residues 9
Acidic residues 2
Hydrophobic residues 16
Net charge 7
Boman Index -5007
Hydrophobicity -18.65
Aliphatic Index 108.11
Half Life
Mammalian: 1 hour
Yeast: 2 min
E.coli: 2 min
Extinction Coefficient cystines 5500
Absorbance 280nm 152.78
Polar residues 7
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 28347740
Title Selective cytotoxicity of the antibacterial peptide ABP-dHC-Cecropin A and its analog towards leukemia cells
Doi 10.1016/j.ejphar.2017.03.054
Year 2017
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.