This work is licensed under a Creative Commons Attribution 4.0 International License.
LysAB2 P3
General Information
DRACP ID DRACP00785
Peptide Name LysAB2 P3
Sequence NPEKALEKLIAIQKAIKGMLNGWFTGVGFRRKR
Sequence Length 33
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| A549 | Lung adenocarcinoma | Carcinoma | Not active up to 200 µm | MTT assay | 24h | 1 |
Hemolytic Activity Human erythrocytes: 1.97% Hemolysis=4µM; <10% Hemolysis=256µM
Normal (non-cancerous) Cytotoxicity HaCat: Not active up to 200 µM
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C172H285N51O42S
Absent amino acids CDHSY
Common amino acids K
Mass 434250
Pl 11.78
Basic residues 8
Acidic residues 2
Hydrophobic residues 13
Net charge 6
Boman Index -5413
Hydrophobicity -40.3
Aliphatic Index 88.79
Half Life
Mammalian: 1.1 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 5500
Absorbance 280nm 171.88
Polar residues 7
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 28904355
Title Highly potent antimicrobial modified peptides derived from the Acinetobacter baumannii phage endolysin LysAB2
Doi 10.1038/s41598-017-11832-7
Year 2017
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.