This work is licensed under a Creative Commons Attribution 4.0 International License.
HlDFS2
General Information
DRACP ID DRACP00799
Peptide Name HlDFS2
Sequence GFGCPLNQGACHRHCRSIRRRGGYCSGIIKQTCTCY
Sequence Length 36
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| A549 | Lung adenocarcinoma | Carcinoma | Not active up to 20 µM | Cell Viability Assay | 24h | 1 |
| K562 | Blast phase chronic myelogenous leukemia, BCR-ABL30 positive; Chronic myeloid leukemia | Leukemia | Not active up to 20 µM | Cell Viability Assay | 24h | 1 |
| THP-1 | Childhood acute monocytic leukemia; Acute monoblastic/monocytic leukemia | Leukemia | Not active up to 20 µM | Cell Viability Assay | 24h | 1 |
Hemolytic Activity Human erythrocytes: <5% Hemolysis=50µM
Normal (non-cancerous) Cytotoxicity HEK293T: Not active up to 20 µM
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys4<--->Cys25; Cys11<--->Cys33; Cys15<--->Cys35
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C165H265N59O46S6
Absent amino acids DEMVW
Common amino acids CG
Mass 462813
Pl 9.18
Basic residues 8
Acidic residues 0
Hydrophobic residues 6
Net charge 8
Boman Index -8162
Hydrophobicity -44.44
Aliphatic Index 46.11
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 3355
Absorbance 280nm 95.86
Polar residues 19
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 28969703
Title Functional characterization of two defensins, HlDFS1 and HlDFS2, from the hard tick Haemaphysalis longicornis
Year 2017
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.