This work is licensed under a Creative Commons Attribution 4.0 International License.
Em-Pis1
General Information
DRACP ID DRACP00827
Peptide Name Em-Pis1
Sequence FIFHIIKGLFHAGKMIHGLVTRRRHGVEELQDLDQRAFEREKAFA
Sequence Length 45
UniProt ID Not available
PubChem CID Not available
Origin Epinephelus coioides; Epinephelus malabaricus
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| A549 | Lung adenocarcinoma | Carcinoma | 73.5% Killing=20µM | CCK-8 assay | 72h | 1 |
| N2a | Mouse neuroblastoma cells | Blastoma | 65.6% Killing=20µM | CCK-8 assay | 72h | 1 |
Hemolytic Activity Fish erythrocytes:25% Hemolysis=20µM; Rabbit erythrocytes:47% Hemolysis=20µM
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C242H379N73O61S
Absent amino acids CNPSWY
Common amino acids FR
Mass 610421
Pl 10.48
Basic residues 12
Acidic residues 6
Hydrophobic residues 19
Net charge 6
Boman Index -9253
Hydrophobicity -28
Aliphatic Index 91.11
Half Life
Mammalian: 1.9 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 0
Absorbance 280nm 0
Polar residues 5
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 30032476
Title EmPis-1L, an Effective Antimicrobial Peptide Against the Antibiotic-Resistant VBNC State Cells of Pathogenic Bacteria
Year 2019
Literature 2
Pubmed ID 27554395
Title Two isoforms of piscidin from Malabar grouper, Epinephelus malabaricus: Expression and functional characterization
Year 2016
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.