NoD173
General Information
DRACP ID DRACP00866
Peptide Name NoD173
Sequence RQCKAESNTFTGICIAKPPCRQACIREKFTDGHCSKVLRRCLCTKRC
Sequence Length 47
UniProt ID Not available
PubChem CID Not available
Origin Nicotiana occidentalis
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| HeLa | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | IC50=1.35±0.06 μM | MTT assay | 48h | 1 |
| MM170 | Melanoma | Carcinoma | IC50=1.75±0.06 μM | MTT assay | 48h | 1 |
| PC-3 | Prostate carcinoma | Carcinoma | IC50=6.31±0.099 μM | MTT assay | 48h | 1 |
Hemolytic Activity Human red blood cells: with ∼12% lysis at the very high concentration (100 µM)
Normal (non-cancerous) Cytotoxicity HUVEC: IC50=12.31±0.08 μM; AHDF: IC50=10.17±0.29 μM
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antitumor; Antimicrobial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C222H377N75O63S8
Absent amino acids MWY
Common amino acids C
Mass 618207
Pl 9.34
Basic residues 12
Acidic residues 3
Hydrophobic residues 11
Net charge 9
Boman Index -12692
Hydrophobicity -48.51
Aliphatic Index 54.04
Half Life
Mammalian: 1 hour
Yeast: 2 min
E.coli: 2 min
Extinction Coefficient cystines 500
Absorbance 280nm 10.87
Polar residues 17
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 30794440
Title Structural and functional characterization of the membrane-permeabilizing activity of Nicotiana occidentalis defensin NoD173 and protein engineering to enhance oncolysis
Year 2019
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available