NoD173

General Information


DRACP ID  DRACP00866

Peptide Name   NoD173

Sequence  RQCKAESNTFTGICIAKPPCRQACIREKFTDGHCSKVLRRCLCTKRC

Sequence Length  47

UniProt ID  Not available

PubChem CID  Not available

Origin  Nicotiana occidentalis

Type  Native peptide

Classification

  

Active ACP



Activity Information


Cell Line Disease Cancer Classified Activity Assay Testing Time Literature
HeLa Human papillomavirus-related endocervical adenocarcinoma Carcinoma IC50=1.35±0.06 μM MTT assay 48h 1
MM170 Melanoma Carcinoma IC50=1.75±0.06 μM MTT assay 48h 1
PC-3 Prostate carcinoma Carcinoma IC50=6.31±0.099 μM MTT assay 48h 1

Hemolytic Activity  Human red blood cells: with ∼12% lysis at the very high concentration (100 µM)

Normal (non-cancerous) Cytotoxicity  HUVEC: IC50=12.31±0.08 μM; AHDF: IC50=10.17±0.29 μM

Target  Not available

Affinity  Not available

Mechanism  Not available

Nature  Anticancer; Antitumor; Antimicrobial



Structure Information


PDB ID  Not available

Predicted Structure  DRACP00866

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C222H377N75O63S8

Absent amino acids  MWY

Common amino acids  C

Mass  618207

Pl  9.34

Basic residues  12

Acidic residues  3

Hydrophobic residues  11

Net charge  9

Boman Index  -12692

Hydrophobicity  -48.51

Aliphatic Index  54.04

Half Life 
  Mammalian: 1 hour
  Yeast: 2 min
  E.coli: 2 min

Extinction Coefficient cystines  500

Absorbance 280nm  10.87

Polar residues  17

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 30794440

Title  Structural and functional characterization of the membrane-permeabilizing activity of Nicotiana occidentalis defensin NoD173 and protein engineering to enhance oncolysis

Doi 10.1096/fj.201802540R

Year  2019

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DRACP is developed by Dr.Zheng's team.