This work is licensed under a Creative Commons Attribution 4.0 International License.
NoD173(A5R)
General Information
DRACP ID DRACP00867
Peptide Name NoD173(A5R)
Sequence RQCKRESNTFTGICIAKPPCRQACIREKFTDGHCSKVLRRCLCTKRC
Sequence Length 47
UniProt ID Not available
PubChem CID Not available
Origin Nicotiana occidentalis
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| HeLa | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | IC50=3.32±0.09 μM | MTT assay | 48h | 1 |
| MM170 | Melanoma | Carcinoma | IC50=3.27±0.12 μM | MTT assay | 48h | 1 |
| PC-3 | Prostate carcinoma | Carcinoma | IC50=12.41±0.14 μM | MTT assay | 48h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity HUVEC: IC50=25.15±0.14 μM
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antitumor; Antimicrobial
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C225H384N78O63S8
Absent amino acids MWY
Common amino acids C
Mass 626717
Pl 9.79
Basic residues 13
Acidic residues 3
Hydrophobic residues 10
Net charge 10
Boman Index -14365
Hydrophobicity -61.91
Aliphatic Index 51.91
Half Life
Mammalian: 1 hour
Yeast: 2 min
E.coli: 2 min
Extinction Coefficient cystines 500
Absorbance 280nm 10.87
Polar residues 17
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 30794440
Title Structural and functional characterization of the membrane-permeabilizing activity of Nicotiana occidentalis defensin NoD173 and protein engineering to enhance oncolysis
Year 2019
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.