Turgencin B
General Information
DRACP ID DRACP00939
Peptide Name Turgencin B
Sequence GIKEMLCNMACAQTVCKKSGGPLCDTCQAACKALG
Sequence Length 35
UniProt ID Not available
PubChem CID Not available
Origin Synoicum turgens
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature | 
|---|---|---|---|---|---|---|
| A2058 | Amelanotic melanoma | Carcinoma | IC50=4.1 µM | AqueousOne assay | 72h | 1 | 
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity MRC-5: IC50=7.5 µM
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys7<--->Cys31; Cys11<--->Cys27; Cys16<--->Cys24
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C143H248N42O46S8
Absent amino acids FHRWY
Common amino acids C
Mass 415497
Pl 8.11
Basic residues 4
Acidic residues 2
Hydrophobic residues 10
Net charge 2
Boman Index -1508
Hydrophobicity 26.86
Aliphatic Index 67.14
                            Half Life  
                              Mammalian: 1.1 hour
  Yeast: 3 min
  E.coli: 2 min
                        
Extinction Coefficient cystines 375
Absorbance 280nm 11.03
Polar residues 14
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 31940927
Title Isolation and Characterization of Antimicrobial Peptides with Unusual Disulfide Connectivity from the Colonial Ascidian Synoicum turgens
Year 2020
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available