This work is licensed under a Creative Commons Attribution 4.0 International License.
Turgencin B Mox1
General Information
DRACP ID DRACP00940
Peptide Name Turgencin B Mox1
Sequence GIKEXLCNMACAQTVCKKSGGPLCDTCQAACKALG
Sequence Length 35
UniProt ID Not available
PubChem CID Not available
Origin Synoicum turgens
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| A2058 | Amelanotic melanoma | Carcinoma | IC50=27.4 µM | AqueousOne assay | 72h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity MRC-5: IC50> 50 µM
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys7<--->Cys31; Cys11<--->Cys27; Cys16<--->Cys24
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification X=MET-OXD
Chiral L
Physicochemical Information
Formula C138H237N41O44S7
Absent amino acids FHRWY
Common amino acids C
Mass 411576
Pl 8.11
Basic residues 4
Acidic residues 2
Hydrophobic residues 10
Net charge 2
Boman Index -1743
Hydrophobicity 21.43
Aliphatic Index 67.14
Half Life
/
Extinction Coefficient cystines 375
Absorbance 280nm 11.03
Polar residues 14
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 31940927
Title Isolation and Characterization of Antimicrobial Peptides with Unusual Disulfide Connectivity from the Colonial Ascidian Synoicum turgens
Year 2020
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.