EtCec2-NH2
General Information
DRACP ID DRACP00989
Peptide Name EtCec2-NH2
Sequence GWLRDFGKRIERTGQNIRDATIQTIGIAQEAANVAATLK
Sequence Length 39
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| HepG2 | Hepatoblastoma | Blastoma | Not active up to 535 µg/ml | CellTiter-Glo ATP assay | 24h | 1 |
Hemolytic Activity Human erythrocytes: Not active up to 512 µg/ml
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C186H309N59O57
Absent amino acids CHMPSY
Common amino acids A
Mass 496188
Pl 10.75
Basic residues 6
Acidic residues 4
Hydrophobic residues 16
Net charge 2
Boman Index -8361
Hydrophobicity -37.69
Aliphatic Index 92.82
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 5500
Absorbance 280nm 144.74
Polar residues 10
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 32344933
Title Antimicrobial Peptides from Rat-Tailed Maggots of the Drone Fly Eristalis tenax Show Potent Activity against Multidrug-Resistant Gram-Negative Bacteria
Doi 10.3390/microorganisms8050626
Year 2020
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available