Hyen C
General Information
DRACP ID DRACP00993
Peptide Name Hyen C
Sequence GTHPCQETCVTSTRCSTQGCHCNWPICFKN
Sequence Length 30
UniProt ID C0HLN7
PubChem CID Not available
Origin medicinal herb Hybanthus enneaspermus
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| HeLa | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | CC50>8 µM | Resazurin assay | 24h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys5<--->Cys15; Cys9<--->Cys20; Cys22<--->Cys27
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C136H209N43O44S6
Absent amino acids ADLMY
Common amino acids C
Mass 386023
Pl 7.78
Basic residues 4
Acidic residues 1
Hydrophobic residues 4
Net charge 3
Boman Index -5678
Hydrophobicity -52.67
Aliphatic Index 22.67
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 5875
Absorbance 280nm 202.59
Polar residues 17
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 32414842
Title Discovery and mechanistic studies of cytotoxic cyclotides from the medicinal herb Hybanthus enneaspermus
Year 2020
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available