Hyen E

General Information


DRACP ID  DRACP00994

Peptide Name   Hyen E

Sequence  GVPCGESCVYIPCFTGIINCSCRDKVCYNN

Sequence Length  30

UniProt ID  C0HLN9 

PubChem CID  Not available

Origin  medicinal herb Hybanthus enneaspermus

Type  Native peptide

Classification

  

Active ACP



Activity Information


Cell Line Disease Cancer Classified Activity Assay Testing Time Literature
K562 Blast phase chronic myelogenous leukemia, BCR-ABL1 positive; Chronic myeloid leukemia Leukemia CC50=2.85±0.09 µM Resazurin assay 24h 1
HeLa Human papillomavirus-related endocervical adenocarcinoma Carcinoma CC50=2.64±0.09 µM Resazurin assay 24h 1
MCF-7 Invasive breast carcinoma of no special type Carcinoma CC50=3.73±0.25 µM Resazurin assay 24h 1

Hemolytic Activity  Human red blood cells (hRBCs): HC50>50 µM

Normal (non-cancerous) Cytotoxicity  HUVEC: CC50=2.06±0.08 µM , testing time is 24h

Target  Not available

Affinity  Not available

Mechanism  Not available

Nature  Anticancer



Structure Information


PDB ID  Not available

Predicted Structure  DRACP00994

Helicity  Not available

Linear/Cyclic  Cyclic

Disulfide/Other Bond  Cys4<--->Cys20; Cys8<--->Cys22; Cys13<--->Cys27

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C137H213N37O43S6

Absent amino acids  AHLMQW

Common amino acids  C

Mass  377624

Pl  6.02

Basic residues  2

Acidic residues  2

Hydrophobic residues  7

Net charge  0

Boman Index  -2521

Hydrophobicity  29

Aliphatic Index  68

Half Life 
  Mammalian: 30 hour
  Yeast: >20 hour
  E.coli: >10 hour

Extinction Coefficient cystines  3355

Absorbance 280nm  115.69

Polar residues  17

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 32414842

Title  Discovery and mechanistic studies of cytotoxic cyclotides from the medicinal herb Hybanthus enneaspermus

Doi 10.1074/jbc.RA120.012627

Year  2020

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DRACP is developed by Dr.Zheng's team.