Hyen M
General Information
DRACP ID DRACP00995
Peptide Name Hyen M
Sequence SIPCAESCVWIPCTVTALLGCSCSDKVCYN
Sequence Length 30
UniProt ID C0HLP
PubChem CID Not available
Origin medicinal herb Hybanthus enneaspermus
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| K562 | Blast phase chronic myelogenous leukemia, BCR-ABL1 positive; Chronic myeloid leukemia | Leukemia | CC50=1.16±0.03 µM | Resazurin assay | 24h | 1 |
| HeLa | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | CC50=1.34±0.04 µM | Resazurin assay | 24h | 1 |
| MCF-7 | Invasive breast carcinoma of no special type | Carcinoma | CC50=2.36±0.16 µM | Resazurin assay | 24h | 1 |
Hemolytic Activity Human red blood cells (hRBCs): HC50>50 µM
Normal (non-cancerous) Cytotoxicity HUVEC: CC50=1.38±0.03 µM, testing time is 24h
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys4<--->Cys20; Cys8<--->Cys22; Cys13<--->Cys27
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C134H213N33O43S6
Absent amino acids FHMQR
Common amino acids C
Mass 368419
Pl 4.18
Basic residues 1
Acidic residues 2
Hydrophobic residues 10
Net charge -1
Boman Index -23
Hydrophobicity 76.67
Aliphatic Index 87.67
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 7365
Absorbance 280nm 253.97
Polar residues 15
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 32414842
Title Discovery and mechanistic studies of cytotoxic cyclotides from the medicinal herb Hybanthus enneaspermus
Year 2020
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available