This work is licensed under a Creative Commons Attribution 4.0 International License.
Brevinin-2SSb
General Information
DRACP ID DRACP01010
Peptide Name Brevinin-2SSb
Sequence SLFSLIKAGAKFLGKNMLKQGPQYPACKVSKDSENVNWKS
Sequence Length 40
UniProt ID Not available
PubChem CID Not available
Origin Glandirana susurra
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| HepG2 | Hepatoblastoma | Blastoma | 95.3% Killing=32µg/ml | MTT assay | 24h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity COS-7: 88.5% Killing=32µg/ml; CPAE: 99.2% Killing=32µg/ml
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C199H319N53O56S2
Absent amino acids HRT
Common amino acids K
Mass 510998
Pl 10.49
Basic residues 7
Acidic residues 2
Hydrophobic residues 13
Net charge 5
Boman Index -4967
Hydrophobicity -47.25
Aliphatic Index 70.75
Half Life
Mammalian: 30 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 6990
Absorbance 280nm 179.23
Polar residues 13
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 32751229
Title Antimicrobial Property and Mode of Action of the Skin Peptides of the Sado Wrinkled Frog, Glandirana susurra, against Animal and Plant Pathogens
Doi 10.3390/antibiotics9080457
Year 2020
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.