hBD-3(human beta-defensin-3)
General Information
DRACP ID DRACP01056
Peptide Name hBD-3(human beta-defensin-3)
Sequence GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
Sequence Length 45
UniProt ID Not available
PubChem CID Not available
Origin Homo sapiens
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature | 
|---|---|---|---|---|---|---|
| HeLa | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | 0% Killing=40 µg/ml | MTT assay | 2h | 1 | 
| A549 | Lung adenocarcinoma | Carcinoma | 30% Killing=40 µg/ml | MTT assay | 2h | 1 | 
Hemolytic Activity Human erythrocytes: 0% Hemolysis=40 µg/ml
Normal (non-cancerous) Cytotoxicity Vero cells: 20% Killing=40 µg/ml
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys11<---Cys40; Cys18<--->Cys33; Cys23<---Cys41
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C216H377N75O59S6
Absent amino acids DFHMW
Common amino acids R
Mass 594620
Pl 10.63
Basic residues 13
Acidic residues 2
Hydrophobic residues 9
Net charge 11
Boman Index -12951
Hydrophobicity -70
Aliphatic Index 67.11
                            Half Life  
                              Mammalian: 1.1 hour
  Yeast: 3 min
  E.coli: 2 min
                        
Extinction Coefficient cystines 3355
Absorbance 280nm 76.25
Polar residues 18
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 34025617
Title A Chimeric Cationic Peptide Composed of Human β-Defensin 3 and Human β-Defensin 4 Exhibits Improved Antibacterial Activity and Salt Resistance
Year 2021
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available