This work is licensed under a Creative Commons Attribution 4.0 International License.
hBD-3(human beta-defensin-3)
General Information
DRACP ID DRACP01056
Peptide Name hBD-3(human beta-defensin-3)
Sequence GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
Sequence Length 45
UniProt ID Not available
PubChem CID Not available
Origin Homo sapiens
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| HeLa | Human papillomavirus-related endocervical adenocarcinoma | Carcinoma | 0% Killing=40 µg/ml | MTT assay | 2h | 1 |
| A549 | Lung adenocarcinoma | Carcinoma | 30% Killing=40 µg/ml | MTT assay | 2h | 1 |
Hemolytic Activity Human erythrocytes: 0% Hemolysis=40 µg/ml
Normal (non-cancerous) Cytotoxicity Vero cells: 20% Killing=40 µg/ml
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys11<---Cys40; Cys18<--->Cys33; Cys23<---Cys41
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C216H377N75O59S6
Absent amino acids DFHMW
Common amino acids R
Mass 594620
Pl 10.63
Basic residues 13
Acidic residues 2
Hydrophobic residues 9
Net charge 11
Boman Index -12951
Hydrophobicity -70
Aliphatic Index 67.11
Half Life
Mammalian: 1.1 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 3355
Absorbance 280nm 76.25
Polar residues 18
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 34025617
Title A Chimeric Cationic Peptide Composed of Human β-Defensin 3 and Human β-Defensin 4 Exhibits Improved Antibacterial Activity and Salt Resistance
Year 2021
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.