This work is licensed under a Creative Commons Attribution 4.0 International License.
Antimicrobial peptide NK-lysin
General Information
DRACP ID DRACP01075
Peptide Name Antimicrobial peptide NK-lysin
Sequence GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE
Sequence Length 78
UniProt ID Not available
PubChem CID Not available
Origin Sus scrofa
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| YAC-1 | Mouse lymphoma | Lymphoma | LC90=50 µg/ml | Esuspension of the cell lines in 1% Nonidet P-40 | 2h | 1 |
Hemolytic Activity Sheep erythrocytes: 0% Hemolysis=170 µM
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial; Antifungal
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys4<--->Cys76; Cys7<--->Cys70; Cys35<--->Cys45
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C391H656N110O111S8
Absent amino acids H
Common amino acids KI
Mass 1030433
Pl 9.15
Basic residues 15
Acidic residues 9
Hydrophobic residues 25
Net charge 6
Boman Index -13691
Hydrophobicity -23.08
Aliphatic Index 93.72
Half Life
Mammalian: 1.1 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 7365
Absorbance 280nm 95.65
Polar residues 19
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 7737114
Title NK-lysin, a novel effector peptide of cytotoxic T and NK cells. Structure and cDNA cloning of the porcine form, induction by interleukin 2, antibacterial and antitumour activity
Doi NA
Year 1995
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.