EH-APP
General Information
DRACP ID DRACP01078
Peptide Name EH-APP
Sequence GEILCNLCTGLINTLENLLTTKGADKVKDYISSLCNKASGFIATLCTKVLDFGIDKLIQLIEDKVDANAICAKIHAC
Sequence Length 77
UniProt ID Not available
PubChem CID Not available
Origin Entamoeba histolytica
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| U-937 | Adult acute monocytic leukemi; Acute monoblastic/monocytic leukemia | Leukemia | LC50=80 µM | Trypan blue assay | 1h | 1 |
| Jurkat | Childhood T acute lymphoblastic leukemia; Precursor T-cell acute lymphoblastic leukemia | Leukemia | LC50=14 µM | Trypan blue assay | 1h | 1 |
Hemolytic Activity Human erythrocytes: 10% Hemolysis=10 µm
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antibacterial
Structure Information
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys5<--->Cys77; Cys8<--->Cys71; Cys35<--->Cys46
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C362H605N93O112S6
Absent amino acids MPRW
Common amino acids L
Mass 960060
Pl 5.74
Basic residues 9
Acidic residues 9
Hydrophobic residues 32
Net charge 0
Boman Index -4478
Hydrophobicity 40.65
Aliphatic Index 121.69
Half Life
Mammalian: 1.9 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 1865
Absorbance 280nm 24.54
Polar residues 26
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 8146160
Title Cytolytic and antibacterial activity of synthetic peptides derived from amoebapore, the pore-forming peptide of Entamoeba histolytica
Year 1994
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available