Peptide Libraray

EH-APP

General Information

DRACP ID DRACP01078

Peptide Name EH-APP

Sequence GEILCNLCTGLINTLENLLTTKGADKVKDYISSLCNKASGFIATLCTKVLDFGIDKLIQLIEDKVDANAICAKIHAC

Sequence Length 77

UniProt ID Not available

PubChem CID Not available

Origin Entamoeba histolytica

Type Native peptide

Classification

Active ACP

Activity Information

Cell Line	Disease	Cancer Classified	Activity	Assay	Testing Time	Literature
U-937	Adult acute monocytic leukemi; Acute monoblastic/monocytic leukemia	Leukemia	LC50=80 µM	Trypan blue assay	1h	1
Jurkat	Childhood T acute lymphoblastic leukemia; Precursor T-cell acute lymphoblastic leukemia	Leukemia	LC50=14 µM	Trypan blue assay	1h	1

Hemolytic Activity Human erythrocytes: 10% Hemolysis=10 µm

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Nature Anticancer; Antibacterial

Structure Information

PDB ID Not available

Predicted Structure DRACP01078

Helicity Not available

Linear/Cyclic Cyclic

Disulfide/Other Bond Cys5<--->Cys77; Cys8<--->Cys71; Cys35<--->Cys46

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C362H605N93O112S6

Absent amino acids MPRW

Common amino acids L

Mass 960060

Pl 5.74

Basic residues 9

Acidic residues 9

Hydrophobic residues 32

Net charge 0

Boman Index -4478

Hydrophobicity 40.65

Aliphatic Index 121.69

Half Life
Mammalian: 1.9 hour
Yeast: >20 hour
E.coli: >10 hour

Extinction Coefficient cystines 1865

Absorbance 280nm 24.54

Polar residues 26

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 8146160

Title Cytolytic and antibacterial activity of synthetic peptides derived from amoebapore, the pore-forming peptide of Entamoeba histolytica

Doi 10.1073/pnas.91.7.2602

Year 1994

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available