This work is licensed under a Creative Commons Attribution 4.0 International License.
VKVR
General Information
DRACP ID DRACP01123
Peptide Name VKVR
Sequence VKDGYIVDDKNCAYFCGRNAYCDDECEKNGAESGYCQWAGVYGNACWCYKLPDKVPIRVPGRCNG
Sequence Length 65
UniProt ID G4V3T9
PubChem CID Not available
Origin Scorpion
Type Native peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| Mouse S180 sarcoma | Mouse S180 sarcoma | Sarcoma | At a dose of 4.4 mg/kg body weight, the tumor weight inhibition rate was 46% | Antitumor in vivo | 7 days | Patent |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer; Antitumor
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C313H463N87O97S8
Absent amino acids HMT
Common amino acids CG
Mass 839491
Pl 4.9
Basic residues 8
Acidic residues 9
Hydrophobic residues 16
Net charge -1
Boman Index -11883
Hydrophobicity -58.92
Aliphatic Index 48
Half Life
Mammalian: 4.4 hour
Yeast: >20 hour
E.coli: >10 hour
Extinction Coefficient cystines 20440
Absorbance 280nm 319.38
Polar residues 28
Amino acid distribution
Literature Information
Literature 1
Pubmed ID Not available
Title Not available
Doi Not available
Year Not available
Patent
Patent ID CN102690342B
Patent Title Anti-cancer analgesic peptide VKVR, its preparation method and application
Other Iinformation Granted Patent; Family: 2s/2ex; Family Jurisdictions: CN; Legal Status: Active; Application No: 201110069002; Filed: Mar 22, 2011; Published: Oct 29, 2014; Earliest Priority: Mar 22, 2011; Granted: Oct 29, 2014
Other Published ID CN102690342B
This work is licensed under a Creative Commons Attribution 4.0 International License.