CB1a, Cecropin-B1a
General Information
DRACP ID DRACP01139
Peptide Name CB1a, Cecropin-B1a
Sequence KWKVFKKIEKKWKVFKKIEKAGPKWKVFKKIEK
Sequence Length 33
UniProt ID P01508
PubChem CID Not available
Origin Not available
Type Synthetic peptide
Classification
Active ACP
Activity Information
| Cell Line | Disease | Cancer Classified | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|---|
| A549 | Lung adenocarcinoma | Carcinoma | As shown in figure 8 | MTT assay | 24 h | Patent |
| LN-229 | Glioblastoma | Blastoma | As shown in figure 8 | MTT assay | 24 h | Patent |
| Hep-G2 | Hepatoblastoma; Hepatoblastoma | Blastoma | As shown in figure 8 | MTT assay | 24 h | Patent |
| AGS | Gastric adenocarcinoma | Carcinoma | IC50=5.6±0.5 µM | MTT assay | 48 h | 1 |
| HL-60 | Adult acute myeloid leukemia; Acute myeloid leukemia | Leukemia | IC50=6.7±1.1 µM | MTT assay | 48 h | 1 |
| CCRF-CEM | Childhood T acute lymphoblastic leukemia; Precursor T-cell acute lymphoblastic leukemia | Leukemia | IC50=4.4±0.3 µM | MTT assay | 48 h | 1 |
| NCI-H520 | Lung squamous cell carcinoma | Carcinoma | IC50=22.7±0.2 µM | MTT assay | 48 h | 1 |
| NCI-H661 | Lung squamous cell carcinoma | Carcinoma | IC50=35.9±0.2 µM | MTT assay | 48 h | 1 |
Hemolytic Activity Human erythrocytes: 18% Hemolysis=200 µM
Normal (non-cancerous) Cytotoxicity RPMI-7666: IC50>100 µM; NIH 3T3: IC50>50 µM; WI-38: IC50>100 µM
Target Not available
Affinity Not available
Mechanism Not available
Nature Anticancer
Structure Information
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C208H335N51O40
Absent amino acids CDHLMNQRSTY
Common amino acids K
Mass 476121
Pl 11.24
Basic residues 15
Acidic residues 3
Hydrophobic residues 13
Net charge 12
Boman Index -5812
Hydrophobicity -113.33
Aliphatic Index 64.85
Half Life
Mammalian: 1.3 hour
Yeast: 3 min
E.coli: 2 min
Extinction Coefficient cystines 16500
Absorbance 280nm 515.63
Polar residues 1
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 19428759
Title Structure and function of a custom anticancer peptide, CB1a
Doi 10.1016/j.peptides.2009.02.004
Year 2009
Patent
Patent ID CN108546285A
Patent Title Anticancer biological active peptide CB1a and applications thereof
Other Iinformation Patent Application; Family: 2s / 2ex; Family Jurisdictions: CN; Legal Status: Active; Application No: 201810184631; Filed: Mar 7, 2018; Published: Sep 18, 2018; Earliest Priority: Mar 7, 2018; Granted: Oct 26, 2021
Other Published ID CN108546285B